GenomeNet

>rs:WP_001020785 [WP_001020785] MULTISPECIES: ADP-forming succinate--CoA ligase subunit beta [Bacillus].
mniheyqgkavlrsygvsvpngkvaftveeaveaakelgtdvcvvkaqihaggrgkaggv
kvaknldevrtyaesilgttlvthqtgpegkevkrllieegcdikkeyyvglvldratsq
vvlmaseeggteieevaektpekifkeyidpavglqgfqarriafninipkelvgqavkf
mmglyrafiekdcsiaeinplvttgdgkvmaldaklnfdsnalyrhkdilelrdldeeda
keieaskydlnyipldgnigcmvngaglamatmdiikhyhgdpanfldvgggataekvte
afkiilsdknvkgifvnifggimkcdviaegvieatkqvglelplvvrlegtnvelgkki
lnesglnivaaesmadgaqkivslvg

BLAST