GenomeNet

>rs:WP_008229961 [WP_008229961] polysaccharide export protein [Roseobacter sp. GAI101].
mlclsarvpahllvlaalimglllgaqgalaqpykikpgdvlrievledpalnrsvlvtp
dgrisvpiagtvrasgkavesvqsnltdrlasgfanppnvfvsverlatpkpyvprqpqt
pqtisvfvvgeaakpgmltvpprttvlqafammggftkfaaqkriqlrrtdkqsglettr
alnypsieagaaqgrtllmdgdvilvpqrrlfe

BLAST