GenomeNet

>rs:WP_036623431 [WP_036623431] MULTISPECIES: hypothetical protein [Paenibacillus].
miiatklhiprsrsslvarsrltrllhegldrtltlitapagygkttllgewvmtlenpv
awvsldqgdndrmrfwahtlaalkqaypsfneqavlrhavedpsgvsliaalvnglhris
qttvlvwddfhhieeesilkgvtyllerlpphvhlylasrnppalplsrlraenrlisld
asdlrfapdetteffakcggiqlsnedaavvqkktegwaaamrlailslhehadpaslvw
kmagterdisdyffdevfslqsetmqhfllytsildrmtgelcqavtgiaesdaylqqld
keslflvaldqrrewyryhhlfrqfltaqlkireprqwktyhmtagkwlekngypheavd
hylaaagyehalsliekiaqelmdkewttlctwlsaipdtllfarpmmlltklasqymsg
hveaatdgywqavrwleentaslpssatetlhaglaflaafrtfmerefeyavqfskeyv
ekhaegefligfgsdrdgyhpvfdiyvsddslqlaeqvltpllsiwsetrniyfvahlyi
dlgkmqyernrlveaekvmrqaydigrthhnislmtiaalwlariaavqgdeetsnqilr
elarltsettnsrlsgkialframlgrmkrdekpvrqwlrksglrfrdeiplsmikeydv
lasilaeqgkmeeaaalterllqlsieegrqsdrirllvhksmilslqgrisdsmdvlee
alalarpegyirtfvdegaplgqlldhyirlrqhqhrrpshkvslsyvkrlrrlipqver
eagtphegtvvvltareqrvlrlmetgmsnkeialklnvslatvkthinniygklqsknr
lqalerartlqlf

BLAST