GenomeNet

>rs:WP_065693237 [WP_065693237] hypothetical protein [Rhizobium sp. AC44/96].
mpseisqpaarlaqgvsrrtllrgsaaigglaiiaaigaplpaaaadsdmqtftrlsefl
tgyqldpvlgarylaalvkrsqtfpadvtalqravtqsgatdmdaflalpaldpaakata
ttivsawylgvvgepadaelityaealmyrptrgilpiptygpgpnnwgpkpdski

BLAST