GenomeNet

>rs:WP_076528632 [WP_076528632] P-type conjugative transfer protein TrbL [Paracoccus saliphilus].
mggtgvideflgvfttyidsgfgllggevafiattlividvtlaalfwawgaeddiiarl
vkktlfvgifaylisnwndlawivfesfaglgllasgtgfsaedlmrpgrvaqtgldagr
pllesisdlmgwvaffenfiqiacllfawvlvilaffilavqlfvtliefklttlagfvl
ipfglfgktafmaervlgnvvssgikvlvlaviigigstlfgqftqgfggispsideama
ivlaalsllglgifgpgiatglvsggpqlgagaaagtglavggaavaaggaamlaaggga
aalsgtaaaarggaalaggastayrlgtggqsgiggtaagmggigraagsvissplkhaa
srtadsmktsyaqgakssvmatggsstmgtlggseasasgnstslsnapgwaqrlrrhpg
lghgarvtahalragdshgsgasvnlsestrs

BLAST