GenomeNet

>rs:XP_004757497 [XP_004757497] PREDICTED: GA-binding protein alpha chain [Mustela putorius furo].
mtkreaeelieieidgtekpecteesiveqtytpaecvsqaidinepignlkklleprlq
csldaheiclqdiqldperslfdqgvktdgtvqlsvqvisyqgiepklnileivkpaetv
evvidpdahhaeaeahlveeaqvitldgtkhittisdetseqvtrwaaalegyrkeqerl
gipydpiqwstdqvlhwvvwvmkefsmtdidlttlnisgrelcslnqedffqrvprgeil
wshlellrkyvlasqeqqmneivtidqpvqiipasvqsatpttikvinssakaakvqrap
risgedrsspgnrtgnngqiqlwqfllelltdkdardciswvgdegefklnqpelvaqkw
gqrknkptmnyeklsralryyydgdmickvqgkrfvykfvcdlktligysaaelnrlvte
ceqkklakmqlhgiaqpvtavalataslqtekdn

BLAST