GenomeNet

>tr:A0A059A1W8_EUCGR [A0A059A1W8] RecName: Full=Homeobox domain-containing protein {ECO:0000259|PROSITE:PS50071};
MELALTLGDTSKPFSFLDKAPKMAGDKESGNRDLGFCMGLGVSGRSSRGGGDEEEDGDGD
KRESPATDRRHHQQHHPPSTLLQLHLLPFSPTNPRNSHHSHKPSTSQFRLPWLTDHLGSE
PESSGGAGRGLDVNRFPAAEEAEQSSPNSALSSFQMEFGIRSGGGAGFRSGSHKRVDMEG
DNERDCSRGSDDDDNGLTRKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQ
VEVWFQNRRARTKLKQTEIDCEYLKRCCETLTEENRRLQKELQELRALKTSQPFYMQLPA
TTLTMCPSCERVATTTAPASAASSPAAAAAAPPLAKPKPRTYPFPHAPQLHHLPQAQPQA
HQAAS

BLAST