GenomeNet

>tr:A0A062U5W4_9RHOB [A0A062U5W4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KCZ53138.1};
MFRYVPWLVICLIAVICAVFWRDYIWLVYMGIPAGALAILGFYDMVQRSHALWRNFPVIA
RIRWIAEELRPFLRSYIVESETEGRPFNNEERAMVYRRAKDVTSVEPFGSHLDIDRPPYE
WLAHSIAAKHTENNDPRVLIGAPGTPQPYSASIFNISAMSFGALGAHAIEALSKGAAMGG
FYHDTGEGGVSRYHKRGGADLVWELGSGYFGCRAKDGGFDAVRFEDTARDPQIKMIEIKL
SQGAKPGHGGVLPGEKVTEEIAEARGIEVGETCVSPPAHSAFSTPIEMLEFAAKLRELSG
GKPVGIKFAVGNRWETLAICKAMLETGLRVDFMVVDGGEGGTGAAPAEFLDHVGAPLRQG
LVLTRNALVGTGLKDDVKLGCSGKQISAFSIASSMALGADWINTARGFMFALGCIQSLNC
HNNTCPTGIATSDKSRQRGLVVDDKAVRVRNFHHNTMNALMEVVGAAGCSHPSELTPRHI
MHRVTEDIIYSAERAYQLVKPGELLDAPEETSLAHEWDMAQAHTFVPRGLRAAR

BLAST