GenomeNet

>tr:A0A067GVN2_CITSI [A0A067GVN2] RecName: Full=Homeobox domain-containing protein {ECO:0000259|PROSITE:PS50071};
MKRKAMAACGNSVCGSQNVGTLLRNEKLPFYSELLDSFWLSKSPTSLQGPQSMAKFENVG
EGGAARASPFQSLDNEDNAYVDFDGWLGQSGKKRRLTATQVQFLERNFEVENKLEPERKV
QLAKELGLQPRQVAIWFQNRRARSRNQRLGKDYDSLKAVYDKLKDDYDNLLKEKQVLQNE
VVINLYATSLSSPLSITAAKAMISLI

BLAST