GenomeNet

>tr:A0A067P6I7_9HOMO [A0A067P6I7] SubName: Full=Glycoside hydrolase family 35 protein {ECO:0000313|EMBL:KDQ50498.1};
MPYATDYRALGSSSPPKRSFTSGRPLWLMLAGLLSAALLLASPGGPSLRSLTSAITGTDY
ADLSARNVAVTEREVAAAEPLQSNNRTQQVQWDNYSLFLNGQRIFLHSGEFHTFRLPVPS
LWPDILQKVKAAGLNAISVYTHMGLINPAPGVVDFGGYRALQPLYEAATEAGIWIVLRPG
PYINAETTAGGLAHWITSEVAGVLRTNATDFYAAWQAYVQGIITETVPYQITNGGPVIAI
QVDNEYSQTYIPGAAGYFAELEAAYHNSSIVVPLTYNDPGEGKNFVNGTGAVDIYGLDSY
PQSFDCSNPTVWDSVVTNYYDYHMGTNPSQPFYIPEFQGGAFDPWGPSAPGYENCRILTG
ADFESVFYHTLWAANVKLINYYMIFGGTSWGAIPFHGVYTSYDYGSSITENRTLTDKYSE
LKRQALFLRSSPEFYKTDWIGNSSTSAVSITNPAAFVVKLQNPDTSAGFYIARQLNSSSL
ATTSFQLAVTTSAGSLELPQVVSNITLTGRQSKVIVTDYTFGSSKVLYSTASVLFAGTIG
GRDVLFLYGDSTQQHEASLALTGIPQWTATDACVGYKTSGGQTIVSFLSGINGLVTVWDS
TTQLVLFADTYTAGTFWNPVIPAASGEFANYWQFGTNTSVLVGGPYLVRNASISGTTLDL
YGDLETGVRLTVIAPPSVKCVTWNGFTVEPDYNAVSSLTYSGGFVSELQPAVAPISVPAL
TGWKYADSLPEVQTSFSDASWTLANHTTTNIPYPMYYGDGRVLYGCDYGYCENIVLWRGH
FNATGSEKSVNLSINGGEAFAASVWLNNQFLNTSYGNSSNNRHILEETDDVFYFPPGSVI
AGQDNAITIVQDNMGLNETDGGLPNTSKSPRGVRGFKLNTGTFSEWKVQGGTYGERQGWH
LPGYDTSSWTSRELSAGLPNSAAGVGFFVTTFDLDTPQGFDIMMSFTFDNTSQPYRAYLF
VNGWMMGKRVSNLGPEYKFPVHEGILDYHGTNTVAVALWSMENVAISPSLELAVDAVFTG
GVGGVVTDNPGWTSVGRV

BLAST