GenomeNet

>tr:A0A069PBJ8_9BURK [A0A069PBJ8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KDR37877.1};
MKKVTAIGLSLMVVSSATAFAEDAPAPVTRAEVRQDLIALEATGWRPKNGFLLYPDDMLA
AGRRVAGPEAARPRAMSGQATRDARAANGAS

BLAST