GenomeNet

>tr:A0A073ITB4_9BACT [A0A073ITB4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KEJ92726.1};
MFDDAMERDVFSGVKVGPALSEAEAVARGLSADSLGLKLEEVYTKYAAEDPEAHARRVWT
AEAVGVPQWIQERDEMYAKEAERRLALLTKGMPDWRGLSEKYPLTARFFEDEDVMASAND
DVEALAAKEGEARRAGAVAKALRGKLSRGGAGRMAAAAAMRNMPKIYREEPEEGLSLGMR
SALDARRMEAGRERYSQRMPISDEAGRAALSAAAKDLSFVNDFLSGSPFGKGASAGYEMA
SISSEAGDLFAAEAFLGRKDEARWVALEKRMLALDRDKPEGWFSGLLYETGKFYGQQARG
AWTTGAMGATGAALGAYAASLGAALPGAASFGMTSGALAGAGAAAIVGAAPVLPAVAAAV
FTAAAGWWLGAKLGVFTQAAKTEAGLDLIERRMMTDEEGNHLSNLSIGLGSMAVGAVNGA
LELFEWETAGRPFLSVARRAVPQATLSTVSAAVTRRLAKLPAAAKITALAAKDWGINVFT
ESMTEVMQDLVPITIDEMQKYALLDGYDMRTLGEVNAQLRETFVSSLYSFSLISALGPAG
GFANRGARYRVELARRELEAAETMRLNRTLDSFAERLFATKLLKRFPGMSREHTQRILEG
ADLSRAYMSASAVETLFQEARKDEGAAAADYESAKEWAVEVLGVDEEDYDRSLDEGYKME
IAAAKVFEAAGDGDAVMEALNRELSWSRDGMTFSEAEEAGRKAAELRTRDFFKLAPQLEL
EALEERSARKLYEAARMQFEEEGVERETAAAWAWVKSRVYIPLARMYSDAMPKEAEKAAK
RGGRELGRFLPEDVERMFPMVIERGEDGKPKGLAFTQAPWSKNGAVTRTEAFKAWFGDWE
NDPENASRILDSNGEPLAAYRGDAAGMTSFGSAQGNYFISDKDTAEGYAGKKGSLYPVYL
NIRNPFVFSEENVASLKEALSARFDDWFDMDDSELAHDGDFQRLRELYAAFRNDEGSVVR
NLYNDFLPQMDESMDDEEARDLMGRSLHDFYAFEARQLDFRDMDILNPYLRMLGFDGMIR
PYDPLATDGGKSEYITFSPEQVKSVENTGTFDANDSNIYLQPVNTDVNPNQKVKVVDLRS
VKVPKDIKTLKDLKAYLLNLPEGHFSTADSKAIIDVLHVNADHIAFTRFPLRKINIPQKE
HVTARNKSIVSLKDLIENSVLVESVPNTKVKPITKSMSKGQVNKTLRKNRKSVYHRFYVP
ITIDGGNFYVVRLVAEEDGKVITINPTKVDLYDVIIEDKKTEKLSALLSPEGPNAALSGS
LMVSIHDLLKNVPDYQGNPYFTQPSRGSIAFPAYDGGPVRITLGKGADRSTFTHELAHLY
LWHLKRLAALDVTYNRAAWTGPTARWNDDLKVVSGWWGENAESIARQAAEFESRSGTALS
CYH

BLAST