GenomeNet

>tr:A0A077B7H1_9ALPH [A0A077B7H1] SubName: Full=Membrane protein V1 {ECO:0000313|EMBL:AIL02919.1};
MARRPGRCAARTSPPKPLPPEPSLSAGAVRRSGLKASDLGASNARPRPQSQRPLQRLLAV
PAIGGMAKFFRKKRGGARSRSVWYEGGTAFPPSAWKGPARTSPYGYESDSDADEASRLRQ
GDGDRSRLASGAAGVRRELGVEAGSPAVLPLNGSRRRDPTPADVYLDGFPTLREQEELQL
APRPVQKSGGAGACCQRLVIANVVILLFQVLVLTGTIFYSLHHGHCNGKQ

BLAST