GenomeNet

>tr:A0A078KQV0_9FIRM [A0A078KQV0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CDZ24847.1};
MDQIKIGKFIAQMRKEKGLTQLQLADMLNISNKTVSKWERGNGLPEVSLMLPLCETLGIN
VNELLTGEKLTDSDYKKKAEENMMDLVKEKEESKKKILLSVIVGIITVIAGIALICVAGM
FEMAVQTRILFIALGLIVIAGGIFTACVLDMDAGTFECRYCKARFKPSAAAYIAGAHTIT
KRRLKCPECGRISYCKKRLTH

BLAST