GenomeNet

>tr:A0A084WKB2_ANOSI [A0A084WKB2] SubName: Full=AGAP006328-PA-like protein {ECO:0000313|EMBL:KFB50656.1};
MGGAQANHSPLYIRVRFSAPERLMHRDSRPPAPQIHCRMLSGKTAIDGGLAPDHRSEARL
RIDPKVLVFVETTYTQLGKSITELLVHNRIKYKVEVAGKSLPVLTNQDKGRYGVIVFENL
DKYLNMDNWNRQLLDKYCRDYSVGIIGFVSPSEETLVGAQLRGFPLYVHTNLRLRDASLN
PGSPVLRLTRAGDTAWGPLPGNDWAIFQHNHSGYEPLEWAQKNVMDYPTDGVAQPPLATV
LQDHGQLDGIQRILFGSGLKFWLHRLLFLDSLSYLSHGQLSLNLERRILIDIDDIFVGEK
GTRLKPDDVHALIATQNRIGEMVPGFRFNLGFSGKYFHHGTHEENLGDDMLLRNVGQFNW
FSHMWNHQQPHLYDNVTQLMNDMMLNKDFAKEHGIPTDSGYSVSPHHSGVYPAHEVLYTA
WKKVWNIKVTSTEEYPHLRPARLRRGFIHRNIMVLPRQTCGLFTHTICIDSYPGGRDKLD
ESIRGGELFQTIVYNPINIFMTHMSNYGNDRLALYTFESVIKFLRCWTNLNLTSVPPLKL
GELYFRLHPEERDPIWGNPADDPRHAKIWAGNKRRTTLPKLLGLGPQKTGSTAFYTFLSM
HPAVASNLPNSDTFEEIQFFNGNNYYRGLDWYLNFFPLQPNDTDDKFMFEKSATYFDGEL
VPRRAHALLPKAQLVTILISPAKRAYSWYQHIKAHGDPIANNYSFYQVITASEGEPKALR
DLRNRCLNPGKYAQHLERWLACYPQQQLYIIDGEQLKSNPVTVMMDLQRFLKLPLFDYSQ
HLRFDNKKGFYCQVVSENRNKCLGKSKGRQYPPMDDRSAKMLQKYYRIHNQALVKLLKKL
GSRPIPQWLKEDLSVTS

BLAST