GenomeNet

>tr:A0A085W747_9DELT [A0A085W747] SubName: Full=PspA/IM30 family protein {ECO:0000313|EMBL:KFE63510.1};
MRSFAGFFVSSIEDPELILEQNVRDLNDQVPKMNESIAMVRANVTLLEKENAKYQQDVRE
LTAKVKAAIQAGRDDLAGQYASRLQIEKQALERNEQQLQIARAAYEKAMNVKKIFMREKE
RKTQEAMNAIRDARRAKWQSKVADAMESFQVAGIDATHDEMLRKVQEGAAVNEARMQMAL
ESVDHQALSIEEEAEKLQANELVKQFKMEMGLDSPAPVSDVGEPAAKTIGKKVEIK

BLAST