GenomeNet

>tr:A0A087TIZ3_9ARAC [A0A087TIZ3] SubName: Full=Ryanodine receptor 44F {ECO:0000313|EMBL:KFM65082.1}; Flags: Fragment;
MAEAEGGSEQDDVSFLRTDDMVCLQCTATGERVCLAAEGFGNRHCFLENIADKNTPPEMS
SCVFVIEQALSVRALQEMVTAMSSESGKSTTSGHRTLLYGHAVLLRHHNSNMYLACLSTS
SSNDKLAFDVGLQEHSQGEACWWTIHPASKQRSEGEKVRVGDDLILVSVATERYLHTARE
GAETIVNASFHLTHWSVAPFGTGSSRVKSVGYVFGGEVLRFFHGGDECLTIPPTWADAPG
QNIVVYEGGAVLNQARSLWRLELIRTKWAGGFINWGYPLRVRHITTGRYLAYNENREVYL
VNKDQASVAATAFGLRQTKDDKKIVLDEKEEEVLGSPLIKYGDTTVFLQHQETGLWLSYR
TYETKKRGVGKVEEKQAIMSEEGKMDDGLEFSRSQEEESRTARVIRKCSFLFNKFIVGLD
SLQREQNEAVKFTAADLEEVIHCLEDLIAYFAQPEEDIEHEEKQNKLKALRNRQDLFQEE
GILNLILDTIDKINMISSSGYLIAFTGEEAAQLWDAISGYLYQLLAAVIKGNHTNCAQFA
QSNRLDWLFSRLGSQQAAEGTGMLDVLHCVLIDSPEALNMMKEDHIKVIISLLEKHGRDP
KVLDVLCSLCVGNGVAVRSSQNNICDNLLPSRSLLLQTRLIDHVASMHPNIFVGKVDGSA
MFRKWYFEAMVDHCETVSHLEPHFRVGWANTKGYVPYPGGGLKWGGNGVGDDIYSYGFDG
AFMWAGGRCNKVRQMDAPFIQKGDVIGCILDLNVPLMSFTVNGIKVKGCFKNFNTDGMFY
PVISFSAKLSCRFILGGDQGRLRYGPPDGHSPLVESLQPKQILTVEPCFEFGELSKGVIN
GPMLELDDTAFVPAPVETTGVTLPGYVENVRDKLAENIHEVWAMNKIGAGWSYGEIRDDV
RKKHPCLTSFDRLPMAEKR

BLAST