GenomeNet

>tr:A0A087VHG1_BALRE [A0A087VHG1] SubName: Full=G protein-activated inward rectifier potassium channel 3 {ECO:0000313|EMBL:KFO12053.1}; Flags: Fragment;
RKRQRYVEKDGKCNVQHGNVRETYRYLTDIFTTLVDLKWRFSLLVFILAYAVTWLFFGLI
WWFIAYCRGDLDHLEDHAWTPCVNNLNGFGHRVITDKCPEGIVLLLLQAILGSMVNAFMV
GCMFVKISQPNKRAETLVFSSHAVVSLRDDRLCLMFRVGDLRDSHIVEASIRAKLIKSKQ
TQEGEFIPLDQTDLSVGFETGDDRLFLVSPLIISHEIDERSPFWDVSRHQLEKDDFEIVV
ILEGMVEATG

BLAST