GenomeNet

>tr:A0A091FJ64_9AVES [A0A091FJ64] SubName: Full=40S ribosomal protein S11 {ECO:0000313|EMBL:KFO69658.1}; Flags: Fragment;
AIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNM
SVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF

BLAST