GenomeNet

>tr:A0A091QIL7_MERNU [A0A091QIL7] SubName: Full=Ryanodine receptor 2 {ECO:0000313|EMBL:KFQ27370.1}; Flags: Fragment;
DDEVVLQCTATVHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVR
ALQEMLANTEEKA

BLAST