GenomeNet

>tr:A0A093EKP4_TAUER [A0A093EKP4] SubName: Full=Ryanodine receptor 2 {ECO:0000313|EMBL:KFV15101.1}; Flags: Fragment;
DDEVVLQCTATVHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVR
ALQEMLANTEEKA

BLAST