GenomeNet

>sp:A0A093FWQ5_TYTAL [A0A093FWQ5] SubName: Full=PR domain zinc finger protein 15 {ECO:0000313|EMBL:KFV58769.1}; Flags: Fragment;
CEDCRQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGTEGVFALTQLVKRT
QFGPFESKRVAKLEKESIFPLKVFRKDGPLVYFDTSNEDDCNWMMMVRPATEYEHQNLTA
FQHDNDIYFTTSRDIPPGTELRVWYAAFYAKKMEKPMLKQVTSIANVNTPEGSGAAEAES
SQWTCKVCSSAFQEPQLLTEHLLSHLEQAKGAPQTSQNEAVAEKAAEPPPVDQPVVCDAA
SAGTDSRRKARRGRKPRTAKAEAPLVIVEEKDSAVERVADVVTEVPPEEVALSSAAEERI
MELVLGKMPSTTNSISSVTKFAHHQNTMSLKRSLILSSRHGIRRKLIKQLGEHKRVYQCS
ICSKIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEVDSEYRYKC
TTCEKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKKHGDKKFACEICNKM
FYRKDVMLDHQRRHLEGVRRVKREEFEHSTENMVRYKKEPSGCPVCGKVFSCRSNMNKHL
LTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENDDNS
DESADSEPHKYSCKRCQLTFGRGKEYLKHIMDVHKEKGYGCSICNRRFALKATYHAHMVI
HRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACEQCGKSFARKDMLKE
HMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKECHRKFAQKVNMLKHYKR
HTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTDYMLQKHIQLTHDK
VEAQSCQLCGTKVSTRASMSRHMRRKHPEILSVRIDDLEQLPETTTIDASSIGIVQPELA
LEQGELPEGKQHIKAPKRGQKRKQKSGEEEEAQVPEDPPFSEYTEKEGEFTGNVGDETNS
AVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTAAGTQFTNLQPVAGGQLTALTRAV
GPHSKTPQPVAVGHLTAPERQLQLDNSILTVTFDTVSGSAMLHNRQNDIQIQPQPEAANP
QSVAHFINLTTLVNSIAPLGNQITEQHPLTWRSVPQADVLQPQAQPAQQQSGQQQVQTEQ
QQQMYSY

BLAST