GenomeNet

>tr:A0A093I6D8_EURHL [A0A093I6D8] SubName: Full=Myc target protein 1 {ECO:0000313|EMBL:KFV97197.1}; Flags: Fragment;
EQITIAFTVSMVVGLAIGGIIWALFTCLSRRRASAHISQGSSSTFSRRSRPSSHGHTSGR
TGFYRNSSCERRSNLSLASLTFQRQASLEQAISFPRKSSFRASTFHPFLQSPPLPVETNS
QLITLTPTNTTTSLVGSTTNSLSRPEFHWSNNNLRICHSTQTPPPAYETIIKAFPDS

BLAST