GenomeNet

>tr:A0A093Y7N4_9PEZI [A0A093Y7N4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KFY00929.1};
MTPMLIPPRRRRPNNRKVGLWIHSCVCLCCVARWSQNFRGEVGICILRVYTTIVEIVPVP
NRPIRSPFFSPTAINKQQVAPHRLHPNIRLSLSTASVPTRRPGASIGLVSNPSPSSAPAF
KRPRFPTMHFSKSLVALAACFLPLIASAELKLRNADAKNVKANSYIVVYNDIDDSTFESE
MFGVHSFLSRRDSTFRGMGHKYKMPTFKGYQIEADMDTVNKISESSHVAYVEKDVMVSAY
ELSVRIGAPWGLDRISHRNGTSEGQEEYTYDSTAGEGTTIYIVDSGINIKHEEFGGRAVW
GKNYVEGSIDEDEDGHGTHVAGIAGGAKYGVASKAHLIAIKVLDAKGDGTSSDVLAGMQW
AADDAEKKNQTGKSVINMSLGAGYSEAFNKATAAIIAKGVVVVAAAGNEDANASGVSPAS
TPDVITVGATYRNDTRAVFSNWGVALDVFAPGVGIKSAWKGNTTATMTISGTSMACPHVA
GLAAYFIGLEKNGTSTPAKITARIKGAATKGVVTDLKNSVNNLAYNDDGY

BLAST