GenomeNet

>tr:A0A094ABT7_9PEZI [A0A094ABT7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KFY20650.1};
MGSWTRHIPRFVWTVVATAAYIAISIPGYSSFEAVLENFMHFIGYWLAIYEGVALTEHFV
FRRSFAAYNVEDYDNRDKLPPGIAAVLAFFCGVVGMVTGMSQTWWVGPVALHAGSAPFGG
DLGFELGFTFAAVSYCLFRTIELRAFKR

BLAST