GenomeNet

>tr:A0A094BER6_9PEZI [A0A094BER6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KFY40159.1};
MHFLKLFAGLFALLWTAHATDNGLQNIVEWDGYSLMINGEREFIYSAEFHYQRMPVPEIW
LDILQKLRANGFNTVSLYFFWSYHSASRDVYDFETSGKNVQRLIDYCKEAGLYVIARSGP
YINAETNGGGFALWGSDGSMGSLRSSDEAYHQSWLPWVTKIGEIIAANEITKGGPVILNQ
LENELQETSHVANASAVIYMEQLKKAFLDAGITVPSSHNEKGQRSMSWSTDYQDVGGSVN
VYGLDSYPGGTSCTNINTGYNVVRNYYQWFSNYSYTQPSYVPEFEGGWFSPWGGTFYDEC
LAEHSPEFADIYYKNNVGQRITMQNLYMTWGGTNWGHSAAPVVYTSYDYSAPLRETRQQW
DKLYQTKLLGLFTRVSKDLLKTYMVGNGTGWSVSTDAIWTWQLANPDTKSGFYVVQHAAT
NSRNNETFSIDLTTTKGNISVPNVSLTGRQSKLIVTDYTFGKHALLYSTAEVLTYGVFDV
DVLVFYLREGDTGQFAFKGMPAHLTYKVYGKSEFAATATNGTTAYVYTQGSGTSVVKFSD
GTIVYLLELWTAWQFWAPSTSENPTVEADKQIFVIGPYLTRSASVKHGDVFVSGDSNSTT
TLEVYAGNSVRNIVWNGKRLPTTKTAWGSVTAKIAGTENRHISLPELKNWKSADSLPEIN
PDYDDSNWVVCDKQTTLSPVAPTTLPVLFSSDYGFYAGAKVYRGYFDGANATSVNLTTSG
GFAFGFNAWLNGQLIGGHGGDPDQHTLTTQLTFSNATLRATGNVLVVLVDYHGHDETSTN
KGVENPRGILGASLSAGSFKTWKIQGNAGGPANIDPVRGPMNEGGLYAERLGWHLPGFDV
SKWSRSEGPAKGLAKSGVQFYVTTFRLAIDADLDAPLGIEFSAPAGTVARLMFWVNGYQF
GKAVFHIGPQLRFPVPPGIINNRGVNTLAISLWAQTDEGARVSDVKLINYGLYQTDFDFN
ADWRYLQPKYVGGREKYA

BLAST