GenomeNet

>tr:A0A094JJ33_9GAMM [A0A094JJ33] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KFZ38059.1};
MGIFTRFADIINSNISALLDKAEDPEKMVRLIIQEMEDTLVEVRSTSAKVLAEKKELIRR
IGKLEEQVADWQSKAELALTKDREDLAKAALIEKQKIAATVDTLSKELDVVDEHIARLKD
EVVQLQEKLADARARQKSIIMRKQTASSRLEVKKQLDSSKIDTAMMKFEQYERRIENIEA
EVEAYELGSKKNKLDDEFAALKADDAVSDELAALKAKMKGKDSAAN

BLAST