GenomeNet

>tr:A0A099ZEI4_TINGU [A0A099ZEI4] SubName: Full=Sterile alpha motif domain-containing protein 14 {ECO:0000313|EMBL:KGL79260.1}; Flags: Fragment;
EPASPTVGLDKKTRRKFLDLGVTLRRASSSKSKKEKGSNRLSMGSRDAAEGSGRAAGSPF
LPFSWFSDGAKGSASPGTASPAGSREGLSPAKSASQVSTSQGAPYGQGAPGRAGPHSARG
PALPSAPQESTLSDDSTPPSSSPRLPGAAATKCSYPYNTLSQSSDEFLDEPPGAAAGWTC
QQVGQWLESLNLEQYVEEFSAHGVDGPRLLHLDGTKLKALGVGSSQDRALLKRKLKELSL
AAEKERKAQEKAEKQREKQKKKDQEQRRS

BLAST