GenomeNet

>tr:A0A0B0MXH0_GOSAR [A0A0B0MXH0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KHG06773.1};
MSDLDIQIPTAFNPFADANAEDSGAGAKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKIL
KDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF

BLAST