GenomeNet

>tr:A0A0B4ERA6_9RHOB [A0A0B4ERA6] SubName: Full=Phage-shock protein {ECO:0000313|EMBL:KID11157.1};
MFNTLKTLITGANARAEEQLRETYSIELITQKIREADANLKAAKLTLASLIQRQRAEQRQ
VETLEERVRDLMARAGEALEGGREDLAQSAAQAVADMENELVVRRQTLDRLDTRILQLRQ
SVETASRRITDLKQGAIAARATRREQDLQRRLRRHTGGDSPAEEAEALIRDVLQRDDPFE
QGEILREIDGELNNTTIADDLADAGFGPRSRSTAADVLSRLKPKD

BLAST