GenomeNet

>tr:A0A0B4ES96_9RHOB [A0A0B4ES96] SubName: Full=Contig24, whole genome shotgun sequence {ECO:0000313|EMBL:KID12325.1};
MGVVSWMVRTADAFLVDAAGSQFGAVASNTGTIVLLMVTLSLIGVCINMAFQFRSMDGAS
FFWYLNKLTLIGLFAFNWANFNAVANAVIGGLDYVAGALVSSVGGGGAGATHFAGEFDIL
IEKFSQYLNAIGSNLNWMTGAILGGIGLVLLSLLGFMTGIVLIFAKMMLTLMLGLAPIMI
ALSLFDSTKDFFHRWVSTTISYAFYPIVIAAMFSTVVGMANSLLGQLGDPNSAANIGSLV
PFFVMVFLAKGFVAATPLIVRGISGNLMVAAAPAVVAGPTGIMRGIFNTDRVKGRARIGA
LTTGEAIGRGAVQTPAAVRSAAATASAQVVRMAERAKRLGG

BLAST