GenomeNet

>tr:A0A0B8ZJZ7_9SPHN [A0A0B8ZJZ7] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834};
MSENPFDEIVRRKRERPFNTFRPAPEPVTTIKAEADGNEFDAIIQRRRGRMLGATLRASP
APDQAAQANRIARARGLPAAVVDPKLQVLQIADQATNFLNMTRLFPHIGSWAEANPRDAA
AAADDTKALGMLGHAFSERDLSRGYSISAPKPVEPSLWNSAKGVWQSLVGGWQQMDTALS
MMIDDRVEAPKWMQGGKAYSDRLKADFVQAQDNVEKATPAFKSETARGIYGGFASLAQMA
PGIGASILTRSPVPAMAIAGAQVGTTAYGKYRVRGGTVNEATTGGLLEGTIEAGFEAIPM
GAVVSRFGKGATSKFLAEIFVKEMATEQATTIAQDAVDTAIANPDKTWGQYFAERPAAAY
QTALGVLVMSGALGGASALASKAQAPETARAQARIERRVRDAEEAQQTAGFLDQIERAAT
ASKFRQRDPVGFANLVAQTAQAQGIESAYIPATASRDFIGESESYL

BLAST