GenomeNet

>tr:A0A0C3PG23_PISTI [A0A0C3PG23] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KIO06884.1};
MPNSAQSFVHAASVDGERPAKRAKVEDSPDQFRSIGGGENEHRPIDGNAIPDAPVNDDFE
DLYGTGPGNTKDEPKTSDLYLDTINRALLDFDFEKVCSVSTSNINTYGCLVCGKYFQGRG
RNSYAYAHSIHDDHHVFINLETAKVYVLPDGYHVSDPSLEDISFVLNPTFTPASISGLSS
PTHLLKPSYDLNNRPYISGYIGLNNIKRNDHMNVIIHSLLHVPPLRDHLLLSNFKGKEPE
LLKRFATLSKKIWNPRLFKSQVSPHEFLQEVNRASGGKFRLEKQGDPVEFLGWLLNHLHK
EMGGSRKKNSSKIYSTFQGELRMETQQVIVRPDASGNEKPKFDIDREIKSTTSPFLFLAI
DLPPPPLFQDAVEKNIIPQVSIYSVLAKYNGVTTQESAGQLRRYKCQRLPPYIILHYKRF
TNNVFVEEKNHTIVTFPLRGVDFREYLDAPPSHPPTVYDLIANVTHESVAGTTRDKENTT
WKVHLRAGGGGGDGEKWFQIQDLIVEETRKEMIFLGESVLQIWERRSASAPNTDGVSVRT
NGDR

BLAST