GenomeNet

>tr:A0A0C4WMM4_9GAMM [A0A0C4WMM4] SubName: Full=2-keto-D-gluconate dehydrogenase,membrane-bound, gamma subunit {ECO:0000313|EMBL:AJE21644.1};
MSKHASVPPGPAPVPAFTLSRRRLLGAACVGAATGALLLSPVAPVWAAAAAEAELSTFME
LSRRLTGRNDLDAKVGQSLHETLLKRDAGFAARLGELQGKLGKTPQGLNEKARDAARQIL
SAWYLGMVGSDYTATVVSYPDALMFKAAGGVIKPRAFCYGMPGSWAEKPGLGRA

BLAST