GenomeNet

>tr:A0A0C5WLZ0_9GAMM [A0A0C5WLZ0] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AJR07302.1};
MAQKLNRMGNSKEDRRVVSTENFGSEVMVESDLIEPRAFSEHDYIILRSYEAVVDGLAAL
IGPFCEIVLHSLADLNTSAIKIANGENTGRKVGSPITDLALRMLRDIEGSERNFSRAYFT
RAKGGDLMKSITIAIRNGDNDIIGLLCININLDAPFSQILQSFMPTDEAKQAASSVNFAS
DVDELVDQTVERTIEEINADKNVSNNAKNRQIVMELFDKGIFDIKDAINRVADRLNISKH
TVYLYIRQRKTEDGEK

BLAST