GenomeNet

>tr:A0A0C9UTZ7_9HOMO [A0A0C9UTZ7] SubName: Full=Unplaced genomic scaffold SPHSTscaffold_33, whole genome shotgun sequence {ECO:0000313|EMBL:KIJ46308.1};
MKNTFGPGAAMKTNEFISFIIFWTISLPLFLLKREQYRIPAIISSVIVTIAAFAIFIWAL
AKQGNVGPLWNNPEEVYGVGRLTGSTLSWAMMRMVNSGIGGWAGGILYQSGDLDFSRYAI
NSGDQTWGQIFIIPICLLGSNILGIIATSCARGLYPEEPLLWKLYDLLEAIQTHGGNGTR
AAVFFAAFAFFLSQLCVNVVACGVVGGMDLAALLPRYIDIRRGSFIIAIIGICINPWKIL
NTANSFISAISGYAVFLGPLTGIMLTEYYVIRRRRIKLSHLFIPNSSSNYWFWHGLNWRA
PIAWVLGVWPSMPGFCASITPAAVQVNITWTHIYYMSWLLGFFISGSVWMVLNTFWPSPG
LGEIDDKDVFGTFGKVDHDNSSNMISSNLVKEQISEDGKPSVVY

BLAST