GenomeNet

>tr:A0A0D0B2D6_9AGAR [A0A0D0B2D6] SubName: Full=Unplaced genomic scaffold GYMLUscaffold_43, whole genome shotgun sequence {ECO:0000313|EMBL:KIK57325.1};
MLVVEPSSSCDVCLEPYEWDDIQRTPHIIDCGHVFCAQCLDRVSPTRCPVCRKLFLPSEV
RKLYVECSTQVAQKEENKEEANLLNELIMVYDGTEEEILILRNRVDEWLGNQVLEEESPL
RKARDALELYQQLKLKRNHDRKKIKSLERDIRHSQESAARKQAEVSIMEQSLRSQLAQQQ
AQIEQLRTEIDKKQILLDQRKVKKPAISKPLPLPKVPITISNPLPSPPRLVQVTANKPTH
RGFSGDHGARGNLHHRLPIYEKEDTLDSPEDNAAYFTCLTAPPVWLHDDISEEPLLQRPF
GDVYH

BLAST