GenomeNet

>tr:A0A0D1ZLB5_9EURO [A0A0D1ZLB5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KIW13602.1};
MAILRLRRPGMAGWSASVKDGLKSRTHVSGWTLPKQPSSVAPPNVWSNADQDPVPPERRT
WTARTFVAYWFSDLVTVSTWSQGSSVVAAGLSASDAMLICFVASMCNAVPIVLNGAIGSA
LHIPFPIAARASYGYWLSFFAVGSRAILALFWFGVNSAAGGLAVTQMIKAIWPSYANLPN
HLPASAGITTQGMVSYVLFHLLQLPFLFIPMHRLQPLFLAKVIVMPPVAIGMVSWIATQA
GGNDFFDAPATVSGNTRVWLWLASMTSVTASYSTLAVNIPDFSRFAKSLRAQIWQLPFIP
IFKVVIAACGIISASASKKIYGEALWNPLLIIDNWHGSSGGRAAAFFCSICWCLAQICLN
ISANSLSFSNDITSLLPRFINIRRGSVICFLIGGWALCPWLILKSGQTFLNFMSAYAIFM
APLAGFLMCDYWIVKRRRYDVPALYDPNGIYGKCNWRSLIILIITIVPMLPGLANKVSPD
TVHIPTGLQHLFAINWLYGFCLTVVLYAVLNFVFPDKKTLIPRVIEGISSPEVVDVEDPS
SDSKSQHVSAEQVNSD

BLAST