GenomeNet

>tr:A0A0D2ECD6_9EURO [A0A0D2ECD6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KIW52365.1};
MTSEYESKEIKLTVDAAGDSAAGDLSEKSFWYKSRKWIRSIGAEELGIERIPEEIRTNQN
PRDLFTVFFSANCNTATLALGFLGPTLFGLGWWDSFCCLLFFNLFGAIFPALVARFGPKL
GLRTMIIPRYSFGWWPAKILAILNCINQIGWAMVNAISGASVLYDVGDGDLPLAVAVLIV
GVLAIAMGLLGYKVLHIYDRYSWIVMLICFIIVAGFGAKNYVNVPMGSGSLEASNVLSFS
TAIIGFEIAWLPVAADYGVYMRETTKDRKSFWWAYGGFLTSQLFIELLGAAVGTLSLSTN
TYFTDAYDARGIGGLIGASFGVYGKGARGFGKLIEVLLGLSCVAVITTNIYSLGLSVQMV
SQKLLVVPRLVWSLIGSVIFLAAAMAGRDHLEVAMENFLLICAYWIVPFSTIVLVEHFIW
RRGYKYDLTAWNNRTKLPYGVAASVAWVVGTVLSLLTMSQAWWVGPIAGGIGSSPYGTDI
SWILGFAATAVVYVPLRMWEQKQWHLF

BLAST