GenomeNet

>sp:A0A0D2IT87_9EURO [A0A0D2IT87] SubName: Full=Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.1, whole genome shotgun sequence {ECO:0000313|EMBL:KIX09264.1};
MEDPPLASLSLTHVHYNPNDPISFLSAWLALVPQGLCVIYVTLIWASREVEILLMFAGQI
ACEALNFGLKRLIREERPRQMYGKGYGMPSSHSQFAAFFSVSLSLFLLFRHAPTPSTSYS
PSTFSERLLLSLLACMGAGAVAASRVYLNYHTPKQVWAGALGGACFAVIWFLFTTYLRRF
GWVDWGLETWLSRKLRMRDLISTEDIQDAGWERWESRRKARRDITSSEESKKTR

BLAST