GenomeNet

>tr:A0A0D2NSM8_9AGAR [A0A0D2NSM8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KJA21874.1};
MVSLTQRFKRKILLPSAVNDANEDLFPTPPEQRTWMWWIYSALWAGQSFDATWWNVGSSL
IGVGLTVTQSIAPMLIGCLALGVAAVLNASFGAHYHVGFPAMIRPTFGVRGSKWFYLLFR
AGLNLDFSALQIYYCGQLMSVMFTCTFGSSYKNWNPAVPVSSGTDAKTLLVYFLAWAIAL
PLTLIHPSKLRTVFMTRAFFGGMAFLAMFVWCTILGQQDPKGFKGFNVLQPNPISGSALG
WAIMSSINSVFGTTAPMITNQSDVSRYAKEPKQAGWPQGFTIFVTKSIVASLSIVATASL
QSRYGGVAQWNVWDQLNLILEENWNAKTRFGCFLIALSVSYSILVTNVYCNSIPFGADIS
ALVPNIVRGQVTIALISLPVLPWQILYVVLTFLGSYTFLMGALLGCQWGDFIVRKGNYHV
PSMYDYGKECIYMYSSRGYNWRGFAAWFISFAVIFPGLISAYIPDKMTEAPKRIYSMGWF
IGVFMSMLCYIAINKVFPVPLVPEEHVDAPEAKEWLGMSSIHGMPCF

BLAST