GenomeNet

>tr:A0A0D2RYS1_GOSRA [A0A0D2RYS1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KJB34651.1};
MATTESAAPPLNDVDIVHLAQRKQPSNSHQQSNVSLPPFLLSPHCHKDLLSYLHSRAASP
SPSSVVCEYVISLLSLISLSPGTPTVCSLLSSLLSSYTQLFPSLPHDSNSLRTIKNFNTL
LIHVPLEDLKLVIDLVASDLSGVVSVDDAQLFDLLPQCFELIRNAEEKGGDYVNSVVDKI
LDSKWSKGFLLKMVSIAKEFSFLDKTRGNEFLEKVFVGIKTVDLMDLPSLVYQLLVLASK
GFNKREIIEGIVYFFGSELGSKMASTVRQVEGTVLLHVNFAVKQDPSLGKEVMGLVKSDL
RAFNHFTVAVLLSVSRVRRFSESSMAILKTALLTAYRDYKFTKECKWIPDDIKGEYLKSV
KVVEKSVLRAVNESNYGREHMVPSILQFGFILLESVGEVNCKELGNSNGLLGIEELGIQM
LKTLFEVHDMARNEIMEQVKFRILSLKPELSRPILRLLCYLIQCYPYPMMEHIPRLKELL
DYFTFMDGKIASYLVSALLPLIRFSRDLRDYAILVVRKAVFRREEAVRVAATNSIIELIL
AEKQPKGDGLFFLQDSSSQASCSQQADIPCSMGGDLFQELSALLQRCLYQQAKVKQVVYQ
GLVKLVLADPAIGGLVFDFLLPHFLQFFKEGPDVQLGVSSCIKSENGKVLIQEPLDCLLS
CISWILLLQTHGKTDKLLDSIGACFGFSLSQENEDGRNMSTEVFSGAFLKIRKFLRNANL
EDILGQTHDASSAAVHEEKWKCSALILSGVIEVVLNTVAMDLEKAADQKVELEKEIMQFV
DRHDSLAKEASTSRQSNAGKRPNLRATAKDATDDIDSGNPKLIQEHTFFLATSSIHQLLL
MALKLYSSESSDIKATSQNHSQSSSSKTSKSCFKIISFALNASLHHVKSSAAVGNEGPMK
KLIYGEINMLGPPLLRLTLLLKPGSNVATSHRKKESKAKKDAEERKEHLLLALFCLKEMI
TVSLCGSCLTHLLENLLSVPELENADLHDECDQASEIDDQDIKNKELFIQKYLKPLLTDL
MKLSAFRTVEILCDILLMIGHKLPCKWRNSHGAWAIRMCKTNNTTNSSIAKSMVRLATSL
SSPPTDLLVAQEMLKELLKFIGPNNSDLSQVSEYLVVNQSTTIAIASCLLQITDNVIIDV
DWSTKKLKAASQVAQKTIHHDQNGEHNLGFTFEEIVYSRIKAVVEVLSSFVLMSLKDNQA
EHFLRLTARFYKNLALISKLKIAPKGQKQLLPSLQFQKLVELTCKELTVPLYNFVAEMQQ
AQQENANSKGMINKIKRENKCIPELIFQIEDYEKHLIRLSKATKMNLLKHAKRSTCRDFK
ILDPTTAVVGQAVPNNVGNDNDNENENENENENGRCSDSEDGNNDGNGSDKELSHEVESE
SDAVEDDRASVPTVKGVKRSRIVHDSDDDS

BLAST