GenomeNet

>tr:A0A0D2UD66_GOSRA [A0A0D2UD66] RecName: Full=STPPase_N domain-containing protein {ECO:0000259|Pfam:PF16891};
MAAATAQGMDPAVLDNIIRWPTEVRSAKPVKQVQLSESEIKQLCVASKDIFVQQPNLLEL
EAPIKICGDIHGQYSDLLRLFEYGGFPPHANYFLVQ

BLAST