GenomeNet

>tr:A0A0D5LVS9_9RHIZ [A0A0D5LVS9] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AJY48070.1};
MNTGRRKLLQSAATLGAIALLPFSAWPKAPQASPNEEFISVSKFLTGRTDLSPEFAQALS
VAFTKTDPAFQSKISKLADFISARNPLAADLAHQLAIDPAYVEIDDLPGTILTGWYLGIA
GIGADAICVTYTQALANRLVADVLSPPSYAYGVYGSWADKPA

BLAST