GenomeNet

>tr:A0A0D6AWK5_RHOSU [A0A0D6AWK5] SubName: Full=Glutathione S-transferase domain-containing protein {ECO:0000313|EMBL:BAQ67273.1};
MYRVIGSGNSRARRVLWMLEELGLSYDHVPALPQTEDVVAINPGGKVPVLIADGVPIPDS
TAILTFLADRHDRFSHPAGTIERALQDSMTQFLLDEFDSALWMAARHSFVLPEELRQSVI
KDSLKWEFIRSQEALVGRMGTGPFLMGTEMTVPDIILTHCGDWAETAHFPVSQPRLAAYL
ERMRARPAYRRAQAA

BLAST