GenomeNet

>tr:A0A0E0NZE1_ORYRU [A0A0E0NZE1] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblPlants:ORUFI03G30290.1};
MAIGGDAGQVVGDGGAGAGDDNIILNPEFDSGLDNWSGSGCKIELHDSLDDGKVLPVSGK
YFVAATGRTDTWNGVQQDVTSRLQRKLLYEVAATVRLSGAAATPSPCEVRATVAVQNTDG
RQQYISVAKSPAVSDKEWVQLQGKFLLNGTVAKAAIYIEGPPAGVDLLLDSLVVKHAQKA
TPAPAPDFKNLEYGANILQNSDLDDGVNGWFGLGSCALSVHGGAPRVLPPMARQSLSPLD
GDDGDGGEPLNGKHIHVTNRAQTWMGPAQVITDRVTPYATYQVSAWVRVGGQQAAGKPQN
INVAVAVDSQWLNGGQVMALDERWYEIGGSFRVESSSTPPSRVMLYVQGPDPGVDLMVAG
LRVFPVDRKARAKHLRKLTDKVRKRDVVVKVTAAAGGAAAADGVEVRVRQVSNSFPLGAC
IMRTNMDNEDYVDFFTKHFNWAVFGNELKWYWTEPEKGQLNYADADDLLKLCADHGMCVR
GHCIFWEVDSAVQQWVKALPADELSAAVASRINGLLTRYKGKFRHYDVNNEMLHGSFYQD
KLGAGARAAMFRAASELDPDALLFVNDYNVEGACVDVRATPEAYIAQVTGLQEQGAAVGG
VGLQGHVTAPVGAVVRAALDRLAVLGLPLWFTELDVSSANEHVRADDLEAMLREAYAHPA
VDGVVLWGFWELSMSRDDAHLVDAEGEVNEAGRRLLQLKREWLTRAHGRADGNGEFRFRG
HHGAYHVDVVTPAGAKISQEFTVDKDDAPLVLNITV

BLAST