GenomeNet

>tr:A0A0F2QJM5_9RHOB [A0A0F2QJM5] SubName: Full=Conjugal transfer protein TrbL {ECO:0000313|EMBL:KJS25117.1}; Flags: Fragment;
MDVIDRFLETFIRYIDSGFGLLQGDVAYLTSTLIVIDITLAGLFWALSQNADVIAGLIKK
VLYVGFFAFLLGNFAGLSQIIFDSFAGLGLKAGSSLITAEDLMRPGYIAGVGYGAALPLL
EEASEMMGPIAFFENFILIAVLLIAWAVILIAFFVLAVQLFVAILEFKLTTLAGFVLVPF
ALWNKTSFLAERVLGNVITSGLKLMVLAIIIGIGSTLFSTITEAFAGTEDVTLAEVMGTV
LAATVFLWMGVFGPGMASGLITGAPQLGAGSA

BLAST