GenomeNet

>tr:A0A0F4YY01_TALEM [A0A0F4YY01] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KKA23157.1};
MAGHEPVEDREQAVSVDENDEGYAELEGSSTSSLRSSIFNYPVENGRQYHAYKSGMYSRP
NDEDELDRLDLVHAMFNLVTEGRLHLAPIGNSPQRILDIGCGTGLWCIEIGDTYPSAEII
GIDLSPTQPIMVPPNVQFEIDDIEEDWTFRRPFDYIHSRYMAGAIQDWPRLMEQCFQHTK
SGGWVEFHDFDPDYYSQDGTLPKDCPLLKWLNYCREACEKRQRTLNPGGRLGQWMRDAGF
VNVHVEKKVLPIGPWPKDSRLKKIGLFNATQLHDGLSGLSMRLFTNVLGWTREEVEVFLV
DVRKDLKNPQIHALMDFFIAYGQKP

BLAST