GenomeNet

>tr:A0A0F4ZDX8_9PEZI [A0A0F4ZDX8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KKA28430.1};
MSVFKRLLDKIAVETEPGLTTAQLMLINNDLKPVESSRRQWGPWNYVGFWIADSFNINTW
MISSSMIVAGLSWWQAWLCVWIGYALAAVFICLTGRIGAVYHIGFPVASRASFGIWGGLW
PVLNRAAMACIWYGVQAYIGGHCVYLMIRSIWKSWDRDKIHNTFSENSGTSTADYASFFI
FWLCSLPAIWFPVEKIRHLFTVKAYVVPCAGLAFLIWAVVRAGGIGPIVHQPSSLHGSAL
AWEFVKGIMSSIANFAALIMNDPDFSRFARNPTAALWPQLLAIPIGFGVTSFIGIIVSSS
STVIYGNSIWDPLELLENFINDGGSAQRFGVFVIAAAFSLAQLGTNIAANSVSAGTDMTA
LLPRYLTIRRGGYICAAVGLAMCPYSLLKSSNMFTTYLSAYSVFLSSIAGVIVFDYYVVR
KGYLDLKELYSGRKDSPYFFTYGVNWRAYVAYVAGILINVVGFAGAIGRHVPVGATYIYN
VNYFAGFLVAGLVYWLLCIVSPIPACSSTWAELDSDVDHFTAVAGQEVYEGVTPDGTYAE
KMAAEGGKYV

BLAST