GenomeNet

>tr:A0A0G0ATV0_9BACT [A0A0G0ATV0] SubName: Full=Putative thymidylate kinase {ECO:0000313|EMBL:KKP60359.1};
MCKEQKSLFPTLIKYPDYDRNVGKIIREFLYENKGLTAQQQFLLYTMQFVMDKKMIETRR
KDEILIADRYFSTTLCYQTLEGIDIKMALDYAKNFQIEVPDAVFYLNVDPDIAIKRKHGE
DKEKNFREKDFDFIKKTHKQYQMLVEKQVWTKWVNIDGNKSVDEVTKEIYNVITNIK

BLAST